Basic Information | |
---|---|
Taxon OID | 3300014497 Open in IMG/M |
Scaffold ID | Ga0182008_10346783 Open in IMG/M |
Source Dataset Name | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 787 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Nebraska | |||||||
Coordinates | Lat. (o) | 41.1591 | Long. (o) | -96.4086 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022954 | Metagenome / Metatranscriptome | 212 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182008_103467832 | F022954 | AGG | VPRFLLRRAGPVGLVLTAWDIWRRIPPRHRKTIVKHARKHGPRIAARVIQAQQQRRRRP* |
⦗Top⦘ |