Basic Information | |
---|---|
Taxon OID | 3300014494 Open in IMG/M |
Scaffold ID | Ga0182017_10262273 Open in IMG/M |
Source Dataset Name | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1089 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Stordalen | |||||||
Coordinates | Lat. (o) | 68.35 | Long. (o) | 19.05 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075615 | Metagenome / Metatranscriptome | 118 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182017_102622732 | F075615 | N/A | MRKQFDSASCPTCDTLFERLPVEYDEDGGYAFLEMHLCAGCSTMLCACCDQFHCDGCGQTFCADHLVSVPDGTHRPLHCCEACAAEFEPLELPARIPPQSEALARPQLEVA* |
⦗Top⦘ |