NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182016_10000867

Scaffold Ga0182016_10000867


Overview

Basic Information
Taxon OID3300014493 Open in IMG/M
Scaffold IDGa0182016_10000867 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)37599
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (65.79%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000290Metagenome / Metatranscriptome1362Y
F000386Metagenome / Metatranscriptome1203Y
F000407Metagenome / Metatranscriptome1172Y

Sequences

Protein IDFamilyRBSSequence
Ga0182016_1000086715F000290GGAMSNSPNARRVGGPRVWAELARPDAEQSQRFLAEELALLLADLLRSVLSDASPALPADEASVERYRRLADSLADGETRRRTSLGITRAGLAKRCVTWLKLLLTPAPNAQTSAPMREFIDALGLFPALFDSEPSARSRRARLTWLLTHDRRLDASTREAATALIEACEHLGVLIWPDADTD*
Ga0182016_1000086718F000407N/AMSRVLDRCALAAAILALVGCHGAYAVRPIPRIAADSVGKPVARLQEAFGAPRKIETTPTKEVYVWFLAQQPAGAPAGFHGCEMEVTVDARSEHVLGYSLSNIGWSKCREVERKIRVAER*
Ga0182016_100008677F000386N/AMNDAASPYLNLHVPPDEMVRYIQDLMTLPQGEIAAGSAMTLAQRQWGGDTPLARAALLRWGALNLAFQDKRLDTWTVARERDRIQVPAALVAAAGIAPLVMDNERAVFDIPALLDATLEFQPPAGQA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.