NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182018_10000053

Scaffold Ga0182018_10000053


Overview

Basic Information
Taxon OID3300014489 Open in IMG/M
Scaffold IDGa0182018_10000053 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)134280
Total Scaffold Genes106 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)66 (62.26%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002480Metagenome / Metatranscriptome555Y
F004553Metagenome / Metatranscriptome433Y
F023653Metagenome / Metatranscriptome209Y

Sequences

Protein IDFamilyRBSSequence
Ga0182018_1000005328F004553AGGAGLNQRFGKTAVAAVVAGALLLFVAAAPRAYSETKQEKCQHAVEKAEARLDRAIHDKGEHSRDADDRRRDLNAERQHCWDENHQWWNGKDHRWETEHNWEEGH*
Ga0182018_1000005330F023653GGAMSTTRLYVECPNCHTQYLMKKGALSYSNGAHIENVAGAPEWQRLLCPCRPGDPYKFKLSETTRLQVFSNDESERTHFFRVKKTPTSDSGS*
Ga0182018_1000005336F002480N/AMNSLPQSRPPWRVPRARLQGNTSAVLRCANGQRLEANLQVVSLTGGLLSLPQPVVQGSQVKVMFLTGDGSVLGGAEMLRPVTNALQPFRFVSLADDDHRRLQKLVWEQTNQNKSEQVWMEKLRAASTRQDSAQPSRLKLAGLVGLLAVGLATAAYVLHFGLLR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.