NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181518_10108947

Scaffold Ga0181518_10108947


Overview

Basic Information
Taxon OID3300014156 Open in IMG/M
Scaffold IDGa0181518_10108947 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1535
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).6 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038913Metagenome / Metatranscriptome165Y
F050025Metagenome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0181518_101089472F038913GGCGGVSGSWEIEAFVSPAREALPGGIGQLLVRVQIVDLDSSDPAAHAFIDLRSTSARQLALEILAAAADADLQTEQDGCPVPAR*
Ga0181518_101089473F050025N/AMSAADRGASTTSASPTLAVPARARALGARLAGLFETDQEIVRGLAAAQHLLAGSNDRLWSDPAADPLSVHHQIHRAFCAYRQASEQRRQLAVDVGELSQQLTDALTAAGYHPQQARKANVHELAAGTWRPTEGKENDR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.