NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0117790_1072410

Scaffold Ga0117790_1072410


Overview

Basic Information
Taxon OID3300014042 Open in IMG/M
Scaffold IDGa0117790_1072410 Open in IMG/M
Source Dataset NameEpidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Valencia
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)548
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus → Epidermal Mucus Viral And Microbial Communities From European Eel In Spain

Source Dataset Sampling Location
Location NameSpain: Alfacada pond
CoordinatesLat. (o)40.647955Long. (o)-0.738702Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005967Metagenome / Metatranscriptome385Y

Sequences

Protein IDFamilyRBSSequence
Ga0117790_10724102F005967N/AMGISVANIAWHNRQPNLFIDTMVKSAAVLNRFRLIDGVKSKVNVPIYDAALSFGSDLCVFDAQSSASIADKEMTVETYKWSFLNCKAVLENTYRSVLLKKGQHNPETMDGEFKDWVFDYFAKLSAQKALELVLQHHHVCLTICLAHC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.