Basic Information | |
---|---|
Taxon OID | 3300013969 Open in IMG/M |
Scaffold ID | Ga0120039_10271 Open in IMG/M |
Source Dataset Name | Marine microbial communities from various locations - University of British Columbia - seawater enrichment SCG69 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of British Columbia |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 602 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092898 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120039_102711 | F092898 | GAGG | MIEQFQEVEFETRTIGPLVLTAPVLQSPGFRGIVNCYCPIAEQADLDHGLVAELVTQVQNSHSQGFCSV* |
⦗Top⦘ |