NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120039_10271

Scaffold Ga0120039_10271


Overview

Basic Information
Taxon OID3300013969 Open in IMG/M
Scaffold IDGa0120039_10271 Open in IMG/M
Source Dataset NameMarine microbial communities from various locations - University of British Columbia - seawater enrichment SCG69
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of British Columbia
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)602
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092898Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0120039_102711F092898GAGGMIEQFQEVEFETRTIGPLVLTAPVLQSPGFRGIVNCYCPIAEQADLDHGLVAELVTQVQNSHSQGFCSV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.