


| Basic Information | |
|---|---|
| Taxon OID | 3300013948 Open in IMG/M |
| Scaffold ID | Ga0116699_1009026 Open in IMG/M |
| Source Dataset Name | Coral microbial communities from a home aquarium in Belgium - AM-T0-control A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Mons |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1024 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral Tissue → Coral Microbial Communities From Home Aquarium In Belgium And Reunion Island, France |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Belgium: Mons, Walloon Region | |||||||
| Coordinates | Lat. (o) | 50.45 | Long. (o) | 3.93 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022326 | Metagenome / Metatranscriptome | 214 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116699_10090261 | F022326 | GAG | VTVEKPKPKQLFRPITTGTNSTMNQSQFLAIIRNSLKAREKSRVRGAIGFGSTPHWLKNWRESF* |
| ⦗Top⦘ |