Basic Information | |
---|---|
Taxon OID | 3300013754 Open in IMG/M |
Scaffold ID | Ga0120183_1012818 Open in IMG/M |
Source Dataset Name | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Georgia Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 622 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Kessler Farm Field Laboratory (KFFL), Okalahoma | |||||||
Coordinates | Lat. (o) | 34.975667 | Long. (o) | -97.519 | Alt. (m) | Depth (m) | 200 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000493 | Metagenome / Metatranscriptome | 1078 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120183_10128181 | F000493 | N/A | SDLIDLGDVYDMAAAVRDATRKAEQVRPNSQASIVWISDGIAPIFFEDRDATEQIIIRKNVIFNSLTVEMRTLFKFLMPIGKPVAGWLGVSLYGSAKHLAQRSGGEAVKVGRAKDYGTGLSKIIGNLTARYSLGFALAESEIDDGRMHSLEVRVKAQDQKGKTRKLQVSSRQGYYMSSTIPKEAAGKGQEAQGWGCMGPPQRGRTV |
⦗Top⦘ |