| Basic Information | |
|---|---|
| Taxon OID | 3300013294 Open in IMG/M |
| Scaffold ID | Ga0120150_1007734 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2365 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Axel Heiberg Island, Nunavut | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .65 | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000805 | Metagenome / Metatranscriptome | 883 | Y |
| F001935 | Metagenome / Metatranscriptome | 615 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120150_10077343 | F000805 | AGGAG | MPSGDSPQHAQQYYHYLQAHQETMQRAATWHVRWIDLAWLWGFVIALTLMLLLWIWQYRSTRQKAGPYPVDSFGGYTTELAGPATLFFLVFTVGVTAFAVVLVVGHLVWGQKF* |
| Ga0120150_10077346 | F001935 | AGGCGG | VYLKHLSSLQFLTYVSFFAVVIAALFKFVPGRSPPVREEPYPEKELHAHDPKTAKYFLAGGFFLVLGALHMAVKNLPWLAEYLARTGYAGHLVRDLSNTHVM |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |