NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172372_10093437

Scaffold Ga0172372_10093437


Overview

Basic Information
Taxon OID3300013132 Open in IMG/M
Scaffold IDGa0172372_10093437 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)2580
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameDemocratic Republic of the Congo: South-Kivu
CoordinatesLat. (o)-1.64Long. (o)29.05Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004838Metagenome / Metatranscriptome421Y

Sequences

Protein IDFamilyRBSSequence
Ga0172372_100934371F004838N/AMALSAQDKILYVANKLGLSTLGQMQGSTGAVYDVDTDLSGQIFSSASRHQNPSVTNITENQFEVNEALLVETVGFYVKDGSNNIVNFQQTYGSGVVIVFDLVIGNKRVMKDTPVFAAGSPYTFANIAQSTGVVAEEASSVFIPRHQVFMEGAGILIPPQVQWYVDYRIFNTVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.