NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163200_1043705

Scaffold Ga0163200_1043705


Overview

Basic Information
Taxon OID3300013088 Open in IMG/M
Scaffold IDGa0163200_1043705 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1356
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)50.0621Long. (o)-124.7214Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079305Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0163200_10437052F079305N/AMIIVLACAGTAMAAGFYVQGNMSEAWDKGSLRVRTGPEMAKLWFGLPAHSGITVVAKPDTGAAVTTTLNMSSTIDLRVPAEYAVTMTRDSGDGQWTCRDAAGSPVLLGFGSSVDEAHHARLTYVADEDKETWKFTWPKEATFLVQLFGKAGKVVEEQDLSDSDEFELVGGGSFTLEVVPTEGSGELLAKKSE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.