NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164295_10067943

Scaffold Ga0164295_10067943


Overview

Basic Information
Taxon OID3300013014 Open in IMG/M
Scaffold IDGa0164295_10067943 Open in IMG/M
Source Dataset NameOligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2660
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.008Long. (o)-89.701Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013761Metagenome / Metatranscriptome268Y
F024310Metagenome / Metatranscriptome206Y
F060912Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0164295_100679431F060912N/AMNKKEIKSAINKAAYALAESMGYEIHDDEGDGTVLFAPHDYTSADDTITWHRSYHNTCVLNWSSDKTKADADAIDAHMKPIIEQYNNQYQSKRATA*
Ga0164295_100679435F024310N/AMNVNELKPNQMIYGNKGNVWTNTAHIFESGKGNLCGTPALATNWARIEGVKVIGCPACLAKANAN*
Ga0164295_100679436F013761N/AMKIELCISRDRVPYIVEELGADRVTVSKYNEDQDLIVFEAGGQMDFLYMFHAGIRCGSDNMARVLTSKVA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.