Basic Information | |
---|---|
Taxon OID | 3300012964 Open in IMG/M |
Scaffold ID | Ga0153916_11623383 Open in IMG/M |
Source Dataset Name | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 721 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Ohio, Lake Erie, Old Woman Creek | |||||||
Coordinates | Lat. (o) | 41.3778 | Long. (o) | -82.5108 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F031771 | Metagenome | 181 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0153916_116233831 | F031771 | N/A | MDLLEWLLEASMVDSTFVQIAPVALPTAQGTVRGTVITAVYALDSLGNVWKLLDHLGQKWMRVTAEREG |
⦗Top⦘ |