Basic Information | |
---|---|
Taxon OID | 3300012919 Open in IMG/M |
Scaffold ID | Ga0160422_10105603 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1663 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | The Central Pacific Ocean | |||||||
Coordinates | Lat. (o) | 10.0 | Long. (o) | -145.0 | Alt. (m) | Depth (m) | 60 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029744 | Metagenome / Metatranscriptome | 187 | N |
F093999 | Metagenome | 106 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0160422_101056032 | F093999 | N/A | MRKNHNRLYYGKHRHKTVFKMPGSLIFFPTTDDHLKLIKKRHPCLSDLNFLADFILKNRNKINFRFQDRRTMFYTDLKLARQLIERMWDFWIGYDTVDPKHGPLGENIIGCTRLPHGKYQYQVHVKKDAQLHISNTQRDNLREFIERNTEHCLVPSYGLLDYLEDKSPYCFGGYFYVTEQQFITPIYMMAQEAIDKIIQFRKVKNGSNKKTA* |
Ga0160422_101056033 | F029744 | N/A | MEAIKKLRDKKIFNDQSIVESMIQKNWMGSPVIKRSLLRVRKINENDCVCEEL |
⦗Top⦘ |