NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138290_1062414

Scaffold Ga0138290_1062414


Overview

Basic Information
Taxon OID3300012773 Open in IMG/M
Scaffold IDGa0138290_1062414 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)978
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Quebec
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001338Metagenome / Metatranscriptome719Y
F013292Metagenome / Metatranscriptome272N

Sequences

Protein IDFamilyRBSSequence
Ga0138290_10624141F001338N/AMTTENNDRPPLTSISTNGTYRLKLIKPKFEKVKVWEDGTCSARLFFVDDKGFCLSKNFSTKYGKALAMLVGKYSGKFTEEIRLDATAAEYLQYLEPACGQTILVGVEVEANGEYNGRPQYKYKMTYPKGSQKPTVADTLPDGQPF*
Ga0138290_10624142F013292N/AMTEAPTPMAAPTLVLISGFARAGKDTLASGLLEWSTRPAEHINFADALKEAGNHFMDYLGLEGNFMAEDFKCENRDALVAMGRFARRLDKDVFARHFANWVPVMKHHDSVSPETVVCSDWRYINELRVCQDILWEKGWKVRTV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.