NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157562_1109540

Scaffold Ga0157562_1109540


Overview

Basic Information
Taxon OID3300012701 Open in IMG/M
Scaffold IDGa0157562_1109540 Open in IMG/M
Source Dataset NameDystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES061 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1774
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016494Metagenome / Metatranscriptome246N
F019949Metagenome / Metatranscriptome226N
F028417Metagenome / Metatranscriptome191N

Sequences

Protein IDFamilyRBSSequence
Ga0157562_11095402F016494N/AMSQKGNSGEEITVDGFTELGQLVKSTLHTVDELFPPKPEFSFEDMMVQFYTLKNKIKKIDSNWKFENTDISYMFEILKLLDAINVEEIPDLQQNAKVCQRLLHRVRIMRQVNPLWSLDVEGIVKFLYPTLNTQPN*
Ga0157562_11095403F028417GAGMATNKSLDNKNQLITLMLQTIENFVPLETRPAPEGMAIYLYELKKEILRQNPKFKFINSYNDYIFRILTLLDYLDVSKEYDTESHGKTVHMICRETRDIKRIDPLWKIDPTSVIEFINSTLLASARK*
Ga0157562_11095404F019949N/AMYQEKNRYSKRTLRFTDDLLYNNSTAEDEANKEILREELEKSIDKSVVFQLAFNTFKIEMQEIKLLRLVEKLLHTVDKMHNLSPLQKARKFSKVYELKQKIIQINLNWKISDSFHLKKYKILTLIDRIDVKEEYNSVANEEIYQQLINEVENAKRTNSTWQLDKELIIIKKIE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.