Basic Information | |
---|---|
Taxon OID | 3300012680 Open in IMG/M |
Scaffold ID | Ga0136612_10020094 Open in IMG/M |
Source Dataset Name | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3328 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctica: Dry Valley | |||||||
Coordinates | Lat. (o) | -78.0456 | Long. (o) | 164.0158 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000584 | Metagenome / Metatranscriptome | 1007 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136612_100200942 | F000584 | GAG | VPEIARKTHHKHSSKKGYRKLLDGLAGLEGVHSVATGRVKPRMGSGRPVAPISKVRHTESGLSITINTEGAIVDAYVVTDRPEEVEAAMGERGWTAP* |
⦗Top⦘ |