Basic Information | |
---|---|
Taxon OID | 3300012533 Open in IMG/M |
Scaffold ID | Ga0138256_10009924 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 9988 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (22.22%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Austria: Klosterneuburg | |||||||
Coordinates | Lat. (o) | 48.3 | Long. (o) | 16.2 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032328 | Metagenome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0138256_100099245 | F032328 | N/A | MKKKILLLFIAWVSTVSVGFSQTDSFDIFTYQTPEFFTKSELQSRVQFQLTNKDGSFCTITLYKSLPAKEDLLKVAMSQWNEQVVKRLAKADKKPSQTLTGKDWDGWPSALSIGNFYQNKKKCVVMLYTFSNSKTSACAVYAFSNKSFKAVIELFSKNLHLSSQ* |
⦗Top⦘ |