| Basic Information | |
|---|---|
| Taxon OID | 3300012516 Open in IMG/M |
| Scaffold ID | Ga0129325_1072270 Open in IMG/M |
| Source Dataset Name | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2300 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → unclassified Actinomycetales → Actinomycetales bacterium mxb001 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Chesapeake Bay | |||||||
| Coordinates | Lat. (o) | 38.0754 | Long. (o) | -76.1533 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015997 | Metagenome / Metatranscriptome | 250 | N |
| F101141 | Metagenome / Metatranscriptome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0129325_10722701 | F101141 | AGG | MKEKPKKERRFLKAIGRVGEILIQEVLIKIGSNLIKKIGGKKTLPSILFLLASLSLFAQFPNTGNKQRLGFQTTGDGLVWRGSESDTASIQPINNQNAWVILDTVNLKFYSFDFTSNVWNSVGGAAFTQPVDSLFFNTGVSTNNVDTAKMRW |
| Ga0129325_10722702 | F015997 | N/A | MSQLIQPSEVIAGGVARPTPADIRIDKSLISPHIQDAEYRWIVPAIGVSFYDTLIADKGSSTAFTSTAYQDLWNSQLKSFCANAVLYEASPYIVMQMGSNGLYTLDNEYGQNVGVEGLKFYQDTLLQRLDVKKKRIKDYLCSCAAGLTGFVSSAIGCPESTCDEHEEITDIYNTLGIVL* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |