Basic Information | |
---|---|
Taxon OID | 3300012506 Open in IMG/M |
Scaffold ID | Ga0157324_1062020 Open in IMG/M |
Source Dataset Name | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 514 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Carolina | |||||||
Coordinates | Lat. (o) | 35.9076 | Long. (o) | -79.0506 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103330 | Metagenome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157324_10620202 | F103330 | N/A | MESDEVFHLTAKISSNSKVADKHPILVNFKPRGGLLTAGARINGANIDLQTIENGAALRGLTFL |
⦗Top⦘ |