Basic Information | |
---|---|
Taxon OID | 3300012416 Open in IMG/M |
Scaffold ID | Ga0138259_1522309 Open in IMG/M |
Source Dataset Name | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 500 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine → Polar Marine Prokaryotic And Eukaryotic Communities From Antarctica During Spring Seasonal Transition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctica | |||||||
Coordinates | Lat. (o) | -64.775 | Long. (o) | -64.053 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003685 | Metatranscriptome | 473 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0138259_15223091 | F003685 | AGAAG | MRVALVLLLCHSAAALRFSSNSTFTVNDKIKINDVVVAEGTGIDQVLGCNTAPKDATSVTVCGCNVKVTAGLLTECQPYGKYSHQVGACDCAQSGCVTNTLQSGYTDKFKWVAASFKVEAC* |
⦗Top⦘ |