Basic Information | |
---|---|
Taxon OID | 3300012411 Open in IMG/M |
Scaffold ID | Ga0153880_1114949 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 553 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Finland: Tavastia Proper, H?meenlinna, Lake Alinen Mustaj?rvi | |||||||
Coordinates | Lat. (o) | 61.2 | Long. (o) | 25.1 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063257 | Metagenome / Metatranscriptome | 129 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0153880_11149491 | F063257 | GAG | MAILKPHPGKELEFAAFLREFYTMMLSKKYSRDMLFQDKKQPGEFVHIRIWLSDEARDSAMHDPAVHHYWMKLPELGVITTIYEDLEPLFSSQEGNTGDILESNL* |
⦗Top⦘ |