NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157139_1000013

Scaffold Ga0157139_1000013


Overview

Basic Information
Taxon OID3300012345 Open in IMG/M
Scaffold IDGa0157139_1000013 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Burnt River, Ontario, Canada - S22
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11884
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (55.56%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameKawartha Lakes, Ontario
CoordinatesLat. (o)44.74057Long. (o)-78.6591Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021767Metagenome / Metatranscriptome217N
F073096Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0157139_10000131F021767GAGGMELEQIKEKMSAGEAKGALIEKVTFAVLPIMFACVVYLMNALSAVHTQLTILEGKMQLVVTSDNKQAPNMGAELAREKLRQDFMQANTEALARSGANKAVLDTLVWRVQELEKFKEKQSSNGGKK*
Ga0157139_10000132F073096GGAGMKKLILLSLVLCLNGCSIMAISAIWPKPHDPVMFDNLVSTKIAIDNLNCDDKTWAWQTAETKLQHLKVYTELRKDPQATSIAQLQEAINKAKASDKKLFCESILKINKTRIDVIVDAWRGR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.