Basic Information | |
---|---|
Taxon OID | 3300012090 Open in IMG/M |
Scaffold ID | Ga0153956_1124567 Open in IMG/M |
Source Dataset Name | Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 794 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Florida, Wekiwa Springs | |||||||
Coordinates | Lat. (o) | 28.7105 | Long. (o) | -81.4844 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021833 | Metagenome / Metatranscriptome | 217 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0153956_11245671 | F021833 | N/A | IAQTATFGDMPMLGSPNLYRGNAPLAMRLKIDDLHAQLAPLERYGVSPMSFAITGGVRALVRSFGALRGAFCSGANGRSGSETL* |
⦗Top⦘ |