Basic Information | |
---|---|
Taxon OID | 3300012081 Open in IMG/M |
Scaffold ID | Ga0154003_1053884 Open in IMG/M |
Source Dataset Name | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 689 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Florida, Lake Talquin State Forest | |||||||
Coordinates | Lat. (o) | 30.4401 | Long. (o) | -84.4954 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010331 | Metagenome / Metatranscriptome | 305 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0154003_10538842 | F010331 | N/A | KLTRDLGQKLYDGYHGVMLGMKSITWAVSKKVGVWPTLAYVPAETNYELITPAG* |
⦗Top⦘ |