NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0154003_1012021

Scaffold Ga0154003_1012021


Overview

Basic Information
Taxon OID3300012081 Open in IMG/M
Scaffold IDGa0154003_1012021 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1856
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: Florida, Lake Talquin State Forest
CoordinatesLat. (o)30.4401Long. (o)-84.4954Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F104663Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0154003_10120212F104663GAGGMKFLKLVLIGIVVVFLAFMGMKVLGVAFRIMFNLFWLALIGLAALALWKMFGPKGAKRVEEAEPENKLQTPELTLDEYKRKLEAQMKQGADVGRR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.