Basic Information | |
---|---|
Taxon OID | 3300012011 Open in IMG/M |
Scaffold ID | Ga0120152_1016978 Open in IMG/M |
Source Dataset Name | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Tennessee |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2856 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Axel Heiberg Island, Nunavut | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .65 | Location on Map | ||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051096 | Metagenome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120152_10169782 | F051096 | GAG | MTDHPTPTPSSATSRANEPDAVVQACVHIDAAARQLEAAANGDVFSSLLGLAGLLALIRGGINPTLRAVVDPGDRLGPIAHVDRALFLLDGAHPSIAPADLLVWTLRLADLRDALPDALLAAWAGRP* |
⦗Top⦘ |