| Basic Information | |
|---|---|
| Taxon OID | 3300011997 Open in IMG/M |
| Scaffold ID | Ga0120162_1000025 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 75488 |
| Total Scaffold Genes | 78 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 20 (25.64%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Axel Heiberg Island, Nunavut | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .8 | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041734 | Metagenome / Metatranscriptome | 159 | N |
| F089942 | Metagenome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120162_100002513 | F041734 | N/A | MATMTKDATVSVRLTAREKSGLDTDARMKGIPSGTAAAGYIAEGVRRSRFPAIEFRDGQPGRVAYLVGSRWPVWMIVELVRELDGNLAEAVKLIRKPAALVRMALAYADAYPQEIKDSAALASRRDYAGMKQEIPELEQL* |
| Ga0120162_100002541 | F089942 | AGG | MNDVRNGFTIYINTFFQGPVPVLTGDDEKFIVFETELEAQKEIVDNAMIRLQQFLDGERDYDDAITVEEYVVPVTVHPDGSFTDEAGKCFGPEREH* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |