NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0156901_1096516

Scaffold Ga0156901_1096516


Overview

Basic Information
Taxon OID3300011975 Open in IMG/M
Scaffold IDGa0156901_1096516 Open in IMG/M
Source Dataset NameSeawater microbial communities from Norwegian Young Sea Ice, Arctic Ocean, Norway, 2015. Combined Assembly of 9 SPs correct ver.
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLGC Genomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3122
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (12.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Norwegian Young Sea Ice 2015 - N-Ice15

Source Dataset Sampling Location
Location NameArctic Ocean
CoordinatesLat. (o)83.166667Long. (o)22.016944Alt. (m)Depth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021649Metagenome / Metatranscriptome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0156901_10965166F021649N/AXXXXGVFYDLMTTEEIDFGIHELFPTDCVHSFLGWAKNAEGTDVEPDELITE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.