


| Basic Information | |
|---|---|
| Taxon OID | 3300011738 Open in IMG/M |
| Scaffold ID | Ga0120086_109082 Open in IMG/M |
| Source Dataset Name | Mine pit pond microbial communities from Vermont, USA - 1M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Vermont |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 558 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond → Mine Pit Pond Microbial Communities From Vermont, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Vermont | |||||||
| Coordinates | Lat. (o) | 43.727094 | Long. (o) | -72.425964 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035651 | Metagenome | 171 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120086_1090822 | F035651 | AGGCGG | MGYYDADPWANHSFNFIDCAECESEFDQQDQEGGNICPTCIDKEEESK* |
| ⦗Top⦘ |