Basic Information | |
---|---|
Taxon OID | 3300011339 Open in IMG/M |
Scaffold ID | Ga0153700_10810 Open in IMG/M |
Source Dataset Name | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chunlab, Inc |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 14989 |
Total Scaffold Genes | 29 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (24.14%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Seoul, South Korea | |||||||
Coordinates | Lat. (o) | 37.5254611 | Long. (o) | 127.0168945 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080033 | Metagenome | 115 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0153700_1081029 | F080033 | N/A | MRKLSELNEPLKAVLESELEKRIPRTDFRQSTLYKIADLLCVMQIKLLEANKTKIVSKTYQDNLNALETLNLAFVLLTDLQGENLLLRNELLTLRHEAEIIIAELSERVKTLEMIDDL* |
⦗Top⦘ |