Basic Information | |
---|---|
Taxon OID | 3300011246 Open in IMG/M |
Scaffold ID | Ga0137490_1014330 Open in IMG/M |
Source Dataset Name | Glacer surface microbial communities from an Arctic cyroconite hole, Midre Lovenbreen, Svalbard, Norway (Sample 22) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Bristol |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 780 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Cryoconite Hole, Glacier Surface → Metagenomes Of Arctic Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Midre Lovenbreen Svalbard, Norway | |||||||
Coordinates | Lat. (o) | 79.48416667 | Long. (o) | 12.09222222 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023385 | Metagenome / Metatranscriptome | 210 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137490_10143303 | F023385 | AGTAG | LRVIFNARRKTGRLDLEAIEMAVRSAMHQAGAAALTQLLQFAAPAADQRSIPCPCGQPAHYRELRAKALLTAVGKAEVSRPYYLCSHCHTG |
⦗Top⦘ |