NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137479_100228

Scaffold Ga0137479_100228


Overview

Basic Information
Taxon OID3300011194 Open in IMG/M
Scaffold IDGa0137479_100228 Open in IMG/M
Source Dataset NameArctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 14 - S13.2.55.2.a - transect 2, repeat 2, age 50-113 years, surface depth).
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8387
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameMidre Lovenbreen Svalbard, Norway
CoordinatesLat. (o)78.90055556Long. (o)12.07611111Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002416Metagenome561Y

Sequences

Protein IDFamilyRBSSequence
Ga0137479_1002285F002416AGGAGMNNLFFLADVPGLEESRAAQLGRRLLAIAFGLKALNGVIASALLIVLGVVSASAQTPGGSFFNGNSSQLGNSLRSVTFFLAAAMIIAGIIFVAVGIITSGLRESLSTWKFITGAACFAFGGVCAAVYAFSQGESVPLDNTF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.