NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151517_1663

Scaffold Ga0151517_1663


Overview

Basic Information
Taxon OID3300011113 Open in IMG/M
Scaffold IDGa0151517_1663 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)11547
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (52.94%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameGangwon-do, South Korea
CoordinatesLat. (o)37.947421Long. (o)127.818872Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002343Metagenome / Metatranscriptome568Y

Sequences

Protein IDFamilyRBSSequence
Ga0151517_16631F002343N/AVELKVSLEEAVAIVNLLGSLPTSQGAHPLWAKLKAQVEPHLPKEEKKEP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.