Basic Information | |
---|---|
Taxon OID | 3300010965 Open in IMG/M |
Scaffold ID | Ga0138308_193686 Open in IMG/M |
Source Dataset Name | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Max Planck Institute for Marine Microbiology, Max Planck Institute for Plant Breeding Research |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1044 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline → Microbial Communities From Lake Cadagno Chemocline, Switzerland. |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Cadagno, Switzerland | |||||||
Coordinates | Lat. (o) | 46.5499 | Long. (o) | 8.711 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066462 | Metagenome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0138308_1936862 | F066462 | N/A | VCEFGKRGGDIAKDFAIDMLFEYEEDDGSTLMWCQGKVVDFIRESKDKHVFVKIEWSDKCVREGDLKITKNQLKKTKWNPSSPVGGAWREDLYHKLMNKE* |
⦗Top⦘ |