NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126356_10051087

Scaffold Ga0126356_10051087


Overview

Basic Information
Taxon OID3300010877 Open in IMG/M
Scaffold IDGa0126356_10051087 Open in IMG/M
Source Dataset NameBoreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)609
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil → Forest Soil Eukaryotic Communities From Alaska, Usa, For A Soil Warming Experiment In A Boreal Forest

Source Dataset Sampling Location
Location NameAlaska, USA
CoordinatesLat. (o)63.883Long. (o)-145.733Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040235Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0126356_100510872F040235N/APKPLLHRPKAPPTLATRFGAGWHALRVAVSWTLAFLGAIAPFAVVLAVAGYVVYRGRRWLNRRRPTAGPASPGS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.