NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136821_1008747

Scaffold Ga0136821_1008747


Overview

Basic Information
Taxon OID3300010387 Open in IMG/M
Scaffold IDGa0136821_1008747 Open in IMG/M
Source Dataset NameAcid mine drainage microbial communities from Malanjkhand copper mine, India - M8 k-mer 51
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterXcelris labs Ltd
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7921
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment → Acid Mine Drainage Microbial Communities From Malanjkhand Copper Mine, India

Source Dataset Sampling Location
Location NameMalanjkhand, India
CoordinatesLat. (o)21.9985Long. (o)80.697983Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002998Metagenome / Metatranscriptome514Y

Sequences

Protein IDFamilyRBSSequence
Ga0136821_10087472F002998N/AMPQETRIAASRFLWDESKGAEKQFLIASLAKAKSLREVTVRKTPVERLVNWTAATLSLPDQIVDDLLKKYLLHEHRAVIISFLDSLKIPHAKGMIEESFDLATLSNDQVQAAARSSLESADRTGAVLYLKYLVLQGGSWAAIEQVLPVGE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.