NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136247_10004519

Scaffold Ga0136247_10004519


Overview

Basic Information
Taxon OID3300010235 Open in IMG/M
Scaffold IDGa0136247_10004519 Open in IMG/M
Source Dataset NameTerrestrial oil reservoir microbial community from Schrader Bluff Formation, Alaska - SB2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterYale Center for Genome Analysis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3704
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska

Source Dataset Sampling Location
Location NameAlaska, USA
CoordinatesLat. (o)70.4Long. (o)-148.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003987Metagenome / Metatranscriptome458Y
F004383Metagenome / Metatranscriptome440Y
F009968Metagenome / Metatranscriptome310Y
F053364Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0136247_1000451910F004383N/AALQQEFDERPDVLDLKRRIERCEEERRQCIAQAQAEGVTKQGSFRLKVRTRKTRTVIPERFFARFGAETFVQCCTIAIGKAEALLGKGTFDDCCEVEVKEIGVSVEYERPEAVE*
Ga0136247_100045192F053364AGGGGGVSDQLNDILVECCKLRGCYPLMHRTLHEFNWFCSCVIWGAGPSIDGEIATAEADGDEALAGALKDRRNEENGIRDRFNDRYKYGADELIRFAEAYREWCREQYGDEEVGA*
Ga0136247_100045193F009968AGGAGGMRSNSCVGCRSHYRERHWWIFEIDFCGLTGDVVGFECPIGCIDTRGCSAYERAFSWPRGAIA*
Ga0136247_100045198F003987AGGAGGMIPALPCGTFADSETPAGAFYVAAFEPGDQPHHVGEYRIDVVIRALLALRAYGYDDVEIGSIESGDHTFLLLIGLDGEARFGDRQLGCIAVAPVGVE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.