| Basic Information | |
|---|---|
| Taxon OID | 3300010153 Open in IMG/M |
| Scaffold ID | Ga0098059_1278588 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 641 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Subarctic Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -16.21 | Long. (o) | -76.63 | Alt. (m) | Depth (m) | 55 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011406 | Metagenome / Metatranscriptome | 291 | Y |
| F101847 | Metagenome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0098059_12785881 | F011406 | GAG | MALVKATLMMELAGYFATYAADPMKPGKDIAKAYKNYLLMGMNAGGFPASAVSAAQPSGMGMGGVFAQQLPVGAAIGTQIATQLTTMALSFMSGQQIGPPVAAPSHTPQLIQLFSGPQPTSLQFAKELAGILDTWTKTWVVSGLIPGAPPVP |
| Ga0098059_12785882 | F101847 | N/A | SGKVKVKGLMASLKEILDTLIDEILNHTHPTGTGPSGPPMPPASVQLNLLKSLKIGMSLE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |