NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126319_1022200

Scaffold Ga0126319_1022200


Overview

Basic Information
Taxon OID3300010147 Open in IMG/M
Scaffold IDGa0126319_1022200 Open in IMG/M
Source Dataset NameSoil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)939
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location
Location NameBig Basin, California
CoordinatesLat. (o)37.1932Long. (o)-122.2204Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018030Metagenome / Metatranscriptome237N
F020741Metagenome / Metatranscriptome222N
F058291Metagenome / Metatranscriptome135N

Sequences

Protein IDFamilyRBSSequence
Ga0126319_10222001F058291N/ATSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERDVALTSKRS*
Ga0126319_10222002F020741GAGMARCGISFLGALLLVLTAQPAPAQIGAFSQSPDREVGNNSRARGAQVECGPIGCRPLPAGCRQVRLGGRWLDNNGLRVVCDSKRN*
Ga0126319_10222003F018030GGAGMDAATSLDDAVRTAQDIMWAALWPGSARAAAVVKLRDLFWSTKMTRALAISSDNCLAFALRQSRIALADTSAWPDKTLSVLWTILDDPALNAALGIPQATDAARRNHPWR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.