NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126310_10167262

Scaffold Ga0126310_10167262


Overview

Basic Information
Taxon OID3300010044 Open in IMG/M
Scaffold IDGa0126310_10167262 Open in IMG/M
Source Dataset NameSerpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1416
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location NameUC McLaughlin Reserve (Lake County, CA)
CoordinatesLat. (o)38.8711Long. (o)-122.4276Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000756Metagenome / Metatranscriptome905Y
F017620Metagenome / Metatranscriptome239Y

Sequences

Protein IDFamilyRBSSequence
Ga0126310_101672621F000756AGGAGGMMDRERPSASDSEDKIPEAWIGQEVMIETTESLSSDLRASAPVYLEDVNERGVVMLVTRHRDQNQFSRYFYPWSVVG
Ga0126310_101672622F017620GGAGVDPTKAAHDEAGLDAGDVGSERYHHALGYLLEEGALLGDEHTATEAGANQAHGYALYFFTRRAVKLLEG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.