| Basic Information | |
|---|---|
| Taxon OID | 3300009870 Open in IMG/M |
| Scaffold ID | Ga0131092_10641192 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 918 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Community Analysis In Wastewater Treatment Plant From Tai Wan |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tai Wan | |||||||
| Coordinates | Lat. (o) | 25.0 | Long. (o) | 121.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026047 | Metagenome / Metatranscriptome | 199 | Y |
| F038748 | Metagenome / Metatranscriptome | 165 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0131092_106411921 | F026047 | GAG | MTRRQSECFRNLDDPLKVFSLLTVKSCGLVLLFYASTVLLELLFGLFTLLFGGWSFLAQIGSALVLAAVLAHAERQDDEHLVPAAIRYYASRRWRVLYSGALG |
| Ga0131092_106411922 | F038748 | AGGA | MTNRPTPAIVLGLLLGILLFAVAPVFAQDPFAGLTNTLNSSARTWAAALMLIGALIAGGAIMMGSRESGHHTRNFLFGAIFLVLAGAGLAIYDRVAGLLN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |