Basic Information | |
---|---|
Taxon OID | 3300009868 Open in IMG/M |
Scaffold ID | Ga0130016_10002248 Open in IMG/M |
Source Dataset Name | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 40328 |
Total Scaffold Genes | 37 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 25 (67.57%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Community In Wastewater Treatment Plant From Tai Wan |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Taiwan | |||||||
Coordinates | Lat. (o) | 25.0 | Long. (o) | 121.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047758 | Metagenome | 149 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0130016_100022484 | F047758 | N/A | MLARLAFVTLAAALLLPAPAHAQKFQAGSPYICPNSDDSGLDCYLDAVVHLYRMCRHVKSIEIIEYGYADAQKGVNGAKSEYCVDKQKLNIVRPYQAALKDATPWREVVDHLRTLQAYWLDSMANLRWRDGEDGGDYEYRVDQVFEELSYKVDDVRVAFTTPPDAADRASAKVAPKAVPKAAPKAKAVARKSP* |
⦗Top⦘ |