| Basic Information | |
|---|---|
| Taxon OID | 3300009868 Open in IMG/M |
| Scaffold ID | Ga0130016_10000118 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 172487 |
| Total Scaffold Genes | 185 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 107 (57.84%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Community In Wastewater Treatment Plant From Tai Wan |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Taiwan | |||||||
| Coordinates | Lat. (o) | 25.0 | Long. (o) | 121.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038260 | Metagenome / Metatranscriptome | 166 | N |
| F040819 | Metagenome | 161 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0130016_10000118121 | F040819 | AGGAGG | MTKAQEVYERVEALVASGVRKADAFRQVADEFGQPFNSMRGAYYAHTRTLGQTAPRPRSKREPVTADPIEAASSVLVRALETIDAEIEAAKTRVEEAKAEYEQLRSTAAERKAALEAKLNALKA* |
| Ga0130016_100001185 | F038260 | GGAG | MTGSDDMHGWAHGEQRADQERELQARFALASMEHALAREAFHVGVALRRAGIELDARTFVALRILEVCVDQLIDPALAIEELVGNGSLDRSIELASELLDRDAA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |