Basic Information | |
---|---|
Taxon OID | 3300009777 Open in IMG/M |
Scaffold ID | Ga0105164_10171395 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1107 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Netherlands | |||||||
Coordinates | Lat. (o) | 52.2278 | Long. (o) | 5.919 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006041 | Metagenome | 383 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105164_101713952 | F006041 | N/A | FGLFKNRDGEPQLVVDQVMYNTPGTPGADFHAMFMNNLFLGQVGFLRENEGFNTYGVWRVDLGERRGFVFNASALVNWGFGVNRAPDPDDVHDPGTRRVDRLRYGIAANARWKQLDVYGAMIWDRIYNLPRELEGRFDRTAAGLTIQADYLAYEQLLLSTRFDQLWAGGLKDEKRDGSVLTLQVRYYPWPNVAFFVRDSVNLRAFENESPLRSWRNQMFVGIDWDF* |
⦗Top⦘ |