NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116162_10240567

Scaffold Ga0116162_10240567


Overview

Basic Information
Taxon OID3300009772 Open in IMG/M
Scaffold IDGa0116162_10240567 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)762
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameHong Kong
CoordinatesLat. (o)22.28Long. (o)114.17Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065813Metagenome / Metatranscriptome127N
F073596Metagenome / Metatranscriptome120N
F095525Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0116162_102405672F095525N/AMKPVTAIWLVALGLVVGVVVGQLLQYNKHRIEDFINKLKKK*
Ga0116162_102405673F073596AGAAGMNVFEKIKLWFTSISKIVKFLTDTFGEAKILKDKQANFKTWADFVIAFIKDALQYADEIAALAQSQPVQTKGQVIKAVKQDKKISTNYQTAYFKKRAQNFKK*
Ga0116162_102405674F065813N/AMTPLISFFGWFDIIIATPFAIYLGYKGVKWIIGKLKKQPQEGEI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.