NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116161_1028348

Scaffold Ga0116161_1028348


Overview

Basic Information
Taxon OID3300009767 Open in IMG/M
Scaffold IDGa0116161_1028348 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3279
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)43.77Long. (o)142.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037746Metagenome / Metatranscriptome167N
F074119Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0116161_10283483F074119GAGGMSEIQVFEVLAKILPYLVSLGIGAFAGWELVKTKIHELAEFFKTVDEALYDDAVTEKEFRAIWEKGRVLFQWSFTAKKGEL*
Ga0116161_10283484F037746GGAGGMPVDIEWAKASDTVGQEFESNYIPGTTDKDLEDARAVMEKLLKKYGGRDALEADERDWAKYKRAMYVVASRSKDTMDRANKAREELIKRKNLLSQFFDGNREILFKLPEWARINLRKYTDYGLLVDQEYLWQALGELGEDGLIEHLLNVANYIYLDTGFLGGTREDYDALQKGPVRSIYHSPTCKSQKTVHPDCGSGCNKV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.