| Basic Information | |
|---|---|
| Taxon OID | 3300009716 Open in IMG/M |
| Scaffold ID | Ga0116191_1129647 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1070 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → unclassified Ignavibacteriales → Ignavibacteriales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hong Kong | |||||||
| Coordinates | Lat. (o) | 22.28 | Long. (o) | 114.17 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071725 | Metagenome | 122 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116191_11296472 | F071725 | AGGAGG | MKTLLNKSESEYLNLGSLDQELSWVLKIYSSGKINDLIYDGLLLFATDEEIKAIREKWQRKEINEVGLFHELEKLSKVESLPG* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |