NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116191_1072460

Scaffold Ga0116191_1072460


Overview

Basic Information
Taxon OID3300009716 Open in IMG/M
Scaffold IDGa0116191_1072460 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC111_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1599
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameHong Kong
CoordinatesLat. (o)22.28Long. (o)114.17Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041512Metagenome / Metatranscriptome160N
F047964Metagenome / Metatranscriptome149N

Sequences

Protein IDFamilyRBSSequence
Ga0116191_10724602F041512AGGAGMEKDYRLIRDLDAYVRIRTKKDTTITLKLKAKIAKMSGEELDIAEVYYHQLLASDIRTLGEIGCIELAVELAAWLYPRILREAYAERSKDYMLAS*
Ga0116191_10724604F047964GGAGGMVNKMDMLIILNRLASVFGKELETNFVDTYSLALKQYPRMALADAAMLCVQENNFMPRPSEIVAKIEKYDLERKWQAVEPSTERMFWVLFRENYDSTDDLTEVDCYEIFGKEYVGAPKVKKVSQTKNMSDEERRNEFRKLYQESKNVSQN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.